Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Glycine max CASP-like protein 3

This Recombinant Glycine max CASP-like protein 3 spans the amino acid sequence from region 1-180.

Product Specifications

Product Name Alternative

CASP-like protein 3

UniProt

C6SZ04

Expression Region

1-180

Origin

Glycine max (Soybean) (Glycine hispida)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKLGMARGEVCLRVSAILVLVLTACLVALDTQTKVVFVSIEKKATYKDLNALKILVYVTC AAAGYNLLLLCKHSIWSRKNFKGSYLCMAWICFSLDQIAVYMTFAANTATMGAAVLAISG SEAFQWLKVCDKFTRFCVEIGGALLCGYAASMLMALISTISAYKVFRMYSPKWFLRLKSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF222 Human qPCR Template Standard (BC030261)
HK200465 1 Kit

ZNF222 Human qPCR Template Standard (BC030261)

Sign In for Pricing
View Details
LCMT1
CSB-CL012808HU1 10 μg Plasmid + 200 μL Glycerol

LCMT1

Sign In for Pricing
View Details
U2AF1L4 Antibody
orb1558525-01 50 μL

U2AF1L4 Antibody

Sign In for Pricing
View Details
U2AF1L4 Antibody
orb1558525-02 100 µL

U2AF1L4 Antibody

Sign In for Pricing
View Details
U2AF1L4 Antibody
orb1558525-03 200 µL

U2AF1L4 Antibody

Sign In for Pricing
View Details
EIF2AK4/GCN2 Rabbit Polyclonal Antibody (BF680)
orb2434953 100 µL

EIF2AK4/GCN2 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details