Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanothermobacter thermautotrophicus Undecaprenyl-diphosphatase (uppP)

This Recombinant Methanothermobacter thermautotrophicus Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-181.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Undecaprenyl pyrophosphate phosphatase

UniProt

O27479

Expression Region

1-181

Origin

Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) (Methanobacterium thermoautotrophicum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVIIGTVPAGLAGVLFKDFFESLFSSLTAVGFFLLVTGFLLWGSENISRRVREKLPVEKL GVRESLIIGCAQALAIAPGISRSGATISAGLFLGFERELAARYSFLLSIPAILGAALIQI KDIGAGMNLLGASMVAGFAAAAVSGYIAIKFLLKLIKERDLYIFAYYCWALGIMILAAAL I

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (Cris-3), CF568 conjugate, 0.1mg/mL
BNC680151-500 1x 500 µL

CD11a (Cris-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF594 conjugate, 0.1mg/mL
BNC940193-500 1x 500 µL

CD86 (BU63), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (H1 + TS1), CF647 conjugate, 0.1mg/mL
BNC470687-500 1x 500 µL

Cytokeratin 8 (H1 + TS1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD1a (O10), CF405S conjugate, 0.1mg/mL
BNC040667-500 1x 500 µL

CD1a (O10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2151), CF488A conjugate, 0.1mg/mL
BNC882151-500 1x 500 µL

TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2151), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18/836), CF488A conjugate, 0.1mg/mL
BNC880836-500 1x 500 µL

Cytokeratin 18 (KRT18/836), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details