Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus thermophilus UPF0397 protein str0306 (str0306)

This Recombinant Streptococcus thermophilus UPF0397 protein str0306 (str0306) spans the amino acid sequence from region 1-181.

Product Specifications

Product Name Alternative

UPF0397 protein str0306

UniProt

Q5M1F2

Expression Region

1-181

Origin

Streptococcus thermophilus (strain CNRZ 1066)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNNSIRTVVATGIGAALFIIIGMFVNIPIFGNTSIQLQYAVQALFSVIFGPITGFFMGF IGHALKDGIQYGNISWAWVLASGITGLVIGLFGKKYDVTMGKFSVMSMIWFNLAQALGLL IAYGVVTPIGDKIQFAQAWSYLYAQSFVAGVANFITIAIGGTLLLAIYASSRTQSGSLTK D

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD47 (B6H12.2), CF640R conjugate, 0.1mg/mL
BNC400437-500 1x 500 µL

CD47 (B6H12.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF640R conjugate, 0.1mg/mL
BNC401003-500 1x 500 µL

Mucin 5AC (MUC5AC) (58M1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF405S conjugate, 0.1mg/mL
BNC042853-100 1x 100 µL

CD54 / ICAM-1 (15.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), 0.2mg/mL
BNUB0345-100 1x 100 µL

CD4 (EDU-2), 0.2mg/mL

Sign In for Pricing
View Details
MTAP (Tumor Suppressor Marker) (MTAP/1813), CF594 conjugate, 0.1mg/mL
BNC941813-100 1x 100 µL

MTAP (Tumor Suppressor Marker) (MTAP/1813), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (CHGA/798), CF594 conjugate, 0.1mg/mL
BNC940798-100 1x 100 µL

Chromogranin A (CHGA/798), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details