Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse PQ-loop repeat-containing protein 3 (Pqlc3)

This Recombinant Mouse PQ-loop repeat-containing protein 3 (Pqlc3) spans the amino acid sequence from region 20-202.

Product Specifications

Product Name Alternative

PQ-loop repeat-containing protein 3

UniProt

Q8C6U2

Expression Region

20-202

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

LKLPQIYAQLAARSARGISLPSLLLELAGFLVFLRYQHYYGNPLLTYLEYPILIAQDIVL LLFVFHFNGNVKQALPYMAVFVSSWFILSLQKWIIDLAMNLCTVISAASKFAQLQYLWKV QDSGAVSALTWGLSAYTCATRIITTLMTTNDLTILIRFVIMLALNIWVTATVLHYRKSAT KAE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospholipase C, Eta 1 Antibody
abx114489 100 µL

Phospholipase C, Eta 1 Antibody

Sign In for Pricing
View Details
Rat Ccl3/C-C motif chemokine 3 ELISA Kit
E0170Ra 96 Tests

Rat Ccl3/C-C motif chemokine 3 ELISA Kit

Sign In for Pricing
View Details
Recombinant Cuscuta obtusiflora Photosystem Q (B) protein
MBS7027156-01 0.02 mg

Recombinant Cuscuta obtusiflora Photosystem Q (B) protein

Sign In for Pricing
View Details
Recombinant Cuscuta obtusiflora Photosystem Q (B) protein
MBS7027156-02 0.1 mg

Recombinant Cuscuta obtusiflora Photosystem Q (B) protein

Sign In for Pricing
View Details
Recombinant Cuscuta obtusiflora Photosystem Q (B) protein
MBS7027156-03 5x 0.1 mg

Recombinant Cuscuta obtusiflora Photosystem Q (B) protein

Sign In for Pricing
View Details
USP22, NT (Ubiquitin Carboxyl-terminal Hydrolase 22, Ubiquitin Thiolesterase 22, Ubiquitin-specific Processing Protease 22, Deubiquitinating Enzyme 22, KIAA1063, USP3L) (MaxLight 750) discontinued
U4101-07-ML750 100 µL

USP22, NT (Ubiquitin Carboxyl-terminal Hydrolase 22, Ubiquitin Thiolesterase 22, Ubiquitin-specific Processing Protease 22, Deubiquitinating Enzyme 22, KIAA1063, USP3L) (MaxLight 750) discontinued

Sign In for Pricing
View Details