Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium perfringens UPF0397 protein CPF_1836 (CPF_1836)

This Recombinant Clostridium perfringens UPF0397 protein CPF_1836 (CPF_1836) spans the amino acid sequence from region 1-185.

Product Specifications

Product Name Alternative

UPF0397 protein CPF_1836

UniProt

Q0TQ20

Expression Region

1-185

Origin

Clostridium perfringens (strain ATCC 13124 / NCTC 8237 / Type A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKNKLSIKTIVAIGIGSAVFMILGRFGSLPTGIPNTNIETAYAFLALMALLYGPLAGFL IGFIGHALKDIVFFGSPWISWVFASGIVGLIIGFGARFIKINQGVFKLKQIFMFNLIQII ANGVAWFLVAPTLDILIYSEPANKVYLQGVIGGISNMVTVGVLGTILIANYAKTRIQKGS LRKEY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL
BNC880225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF680 conjugate, 0.1mg/mL
BNC800146-100 1x 100 µL

CD10 (CB-CALLA), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF488A conjugate, 0.1mg/mL
BNC880218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF568 conjugate, 0.1mg/mL
BNC680324-100 1x 100 µL

CD53 (161-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF740 conjugate, 0.1mg/mL
BNC740965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF594 conjugate, 0.1mg/mL
BNC940152-500 1x 500 µL

CD11c (HC1/1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details