Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_822486 (POPTRDRAFT_822486)

This Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_822486 (POPTRDRAFT_822486) spans the amino acid sequence from region 1-186.

Product Specifications

Product Name Alternative

CASP-like protein POPTRDRAFT_822486

UniProt

B9HTK2

Expression Region

1-186

Origin

Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRSPQPHRSGGDTQQHFQSTVSVQKLKRFNSLILVFRFAAFCFSLASAVFMLTNSRGSDS LHWYNFDAFRYVFAANAIVAIYSLFEMAASVWEISRNATLFPEICQVWFDFGHDQVFAYL LLSANTAGTELARTLKDTCTDNKAFCVQSDIAIVLGFAGFLFLGISSLFSGFRVVCFIIN GSRFYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLT1D1 Human Gene Knockout Kit (CRISPR)
KN415655 1 Kit

GLT1D1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cyclin D1 (CCND1/809), CF405S conjugate, 0.1mg/mL
BNC040809-100 1x 100 µL

Cyclin D1 (CCND1/809), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Allantoic Acid
TRC-A541500-50MG 50 mg

Allantoic Acid

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS647643 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
5-Azacytidine
P012-50MG 50 mg

5-Azacytidine

Sign In for Pricing
View Details
CLIP170 (CLIP1) Rabbit Polyclonal Antibody
AP01464PU-N 100 µg

CLIP170 (CLIP1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details