Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methylobacterium extorquens Methylamine utilization protein mauE (mauE)

This Recombinant Methylobacterium extorquens Methylamine utilization protein mauE (mauE) spans the amino acid sequence from region 1-186.

Product Specifications

Product Name Alternative

Methylamine utilization protein mauE

UniProt

Q49125

Expression Region

1-186

Origin

Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIMALLAEPVVTTFVRAFLILLLASAAIPKLRHGEEFFGVVRNFRLMPEWLARPFALVLP WLELGIAVGLVLPVTAPLAAGLAGGLMVLFGIAIAINVARGRTAIDCGCFRNGMKQKLSW LLVGRNAGLALAAFGLAWLLPVAPAAGPFDLAIGFAAAGLTMLLIYGASLLSGLQSGARS SQLSKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF141 CRISPR Knock Out 293T Cell Line (Human)
51312141 1x 10^6 Cells / 1.0 mL

ZNF141 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Rabbit Monoclonal MAGEA3 Antibody (S07-8A2)
NBP3-19683-100ul 100 µL

Rabbit Monoclonal MAGEA3 Antibody (S07-8A2)

Sign In for Pricing
View Details
Lentiviral human AGAP1 shRNA (UAS) - Lentiviral human AGAP1 shRNA (UAS, RFP) (25)
GTR15350402 1 Vial

Lentiviral human AGAP1 shRNA (UAS) - Lentiviral human AGAP1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
EIF4A2 Polyclonal Antibody
MBS129446-01 0.02 mL

EIF4A2 Polyclonal Antibody

Sign In for Pricing
View Details
EIF4A2 Polyclonal Antibody
MBS129446-02 0.1 mL

EIF4A2 Polyclonal Antibody

Sign In for Pricing
View Details
EIF4A2 Polyclonal Antibody
MBS129446-03 5x 0.1 mL

EIF4A2 Polyclonal Antibody

Sign In for Pricing
View Details