Recombinant Natronomonas pharaonis UPF0290 protein NP0990A (NP0990A)
This Recombinant Natronomonas pharaonis UPF0290 protein NP0990A (NP0990A) spans the amino acid sequence from region 1-189.
Product Specifications
Product Name Alternative
UPF0290 protein NP0990A
UniProt
Q3ITE8
Expression Region
1-189
Origin
Natronomonas pharaonis (strain DSM 2160 / ATCC 35678)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MVAETVAIAVWAMLPAYVPNNVAVLAGGGRPIDGGRTLDKLTDEDGVLYDENRILGDGKT WRGTAFGTAAGVVLALLLNQLQPFVAGTVGVPQFPIAAAVALAFGAMLGDILASFLKRRT GRQRGAAFPGVDQLDFVIVSLALTAIVATGWFLATFTLPVLVAIFVLTPVLHVSTNGLAY AFGLKDEPW
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470009-500 1x 500 µL
MART-1 / Melan-A (M2-7C10), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471037-500 1x 500 µL
CD44 Standard (DF1485), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401041-100 1x 100 µL
TRIM29 (TRIM29/1041), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402730-500 1x 500 µL
Human IgD (Immunoglobulin Delta Heavy Chain) (B-Cell Marker) (IGHD/2730R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details