Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Uncharacterized derlin-like protein C1687.17c (SPAC1687.17c)

This Recombinant Schizosaccharomyces pombe Uncharacterized derlin-like protein C1687.17c (SPAC1687.17c) spans the amino acid sequence from region 1-190.

Product Specifications

Product Name Alternative

Uncharacterized derlin-like protein C1687.17c

UniProt

O94458

Expression Region

1-190

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAILPEFISQTPPVTRYIVLGTLFTTLAVNFGYVSDLKIFFNWKLFLAKGEYWRAITTFL YVGPFGLELILYLSFLLRFMSMLERSSPPPQTQSFLKTVLIVWFSLLVTSYFSYMPFAAS YFSFTMLYIWSWKHPLYRISILGLFDVKAPYVPWVMVLLRWLRTGIFPLLDLISALIGHV YFFVTDFSTV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thrombomodulin / CD141 (Endothelial Cell Marker) (rTHBD/1591), CF647 conjugate, 0.1mg/mL
BNC472332-100 1x 100 µL

Thrombomodulin / CD141 (Endothelial Cell Marker) (rTHBD/1591), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DOG-1 (DG1/447), CF594 conjugate, 0.1mg/mL
BNC940447-100 1x 100 µL

DOG-1 (DG1/447), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 7 (KRT7/1198), CF740 conjugate, 0.1mg/mL
BNC741198-500 1x 500 µL

Cytokeratin 7 (KRT7/1198), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), Biotin conjugate, 0.1mg/mL
BNCB1231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (CGA/414), CF568 conjugate, 0.1mg/mL
BNC680414-100 1x 100 µL

Chromogranin A (CGA/414), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF543 conjugate, 0.1mg/mL
BNC430151-500 1x 500 µL

CD11a (Cris-3), CF543 conjugate, 0.1mg/mL

Sign In for Pricing
View Details