Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macrococcus caseolyticus Glycerol-3-phosphate acyltransferase (plsY)

This Recombinant Macrococcus caseolyticus Glycerol-3-phosphate acyltransferase (plsY) spans the amino acid sequence from region 1-194.

Product Specifications

Product Name Alternative

Glycerol-3-phosphate acyltransferase, Acyl-PO4 G3P acyltransferase, Acyl-phosphate--glycerol-3-phosphate acyltransferase, G3P acyltransferase, GPAT, EC= 2.3.1.n3, Lysophosphati

UniProt

B9EBV6

Expression Region

1-194

Origin

Macrococcus caseolyticus (strain JCSC5402)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQIALLLLIAYLLGAIPTGLIVGKLFFNKDIRKFGSGNLGATNTFRVLGKKAGIFVTIFD VAKGVLPAIFPIIYDLDIHGIWFGLAAIIGHVYPIYLNFKGGKAVATSAGVILGVNPVVF LIIAVIFFTLLFTTRMVSLTSILTSIGNFITTLFFDDIILQIISFLIMLLIIIRHSSNIK RIISGTEPKIQFKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RRAGC Antibody
A15252-50UG 50 µg

RRAGC Antibody

Sign In for Pricing
View Details
MTP18 shRNA Plasmid (m)
sc-149690-SH 20 µg

MTP18 shRNA Plasmid (m)

Sign In for Pricing
View Details
Human THP Antibody Pair Set
E-KAB-0453 50 µL & 100 µg

Human THP Antibody Pair Set

Sign In for Pricing
View Details
Virginiamycin M1
FV159221-01 1 mg

Virginiamycin M1

Sign In for Pricing
View Details
Virginiamycin M1
FV159221-02 2 mg

Virginiamycin M1

Sign In for Pricing
View Details
Virginiamycin M1
FV159221-03 5 mg

Virginiamycin M1

Sign In for Pricing
View Details