Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0979 (MJ0979)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0979 (MJ0979) spans the amino acid sequence from region 1-197.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0979

UniProt

Q58389

Expression Region

1-197

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLPKKIDYIKIALIVVGIIALFLPWLTISASTINIKTDEGIHLSVNLAPFRVSSDIKSDT NNIFVEMMMPYVKQYFDMAVKEKMSTFMMIFGIIPIILYIASIFVDKKAVVVGAGIAGIT CASIFVVLFTVGLNSSDSGLALTGGKEVTPIDLITGVVNEKSSYLSKDIIKIQVGTGWYL TMIIGLALIAYPFIRKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-Isoleucinol · HCl
F-1690.0001 1.0g

L-Isoleucinol · HCl

Sign In for Pricing
View Details
Rabbit polyclonal Met antibody
MBS5304920-01 0.05 mg

Rabbit polyclonal Met antibody

Sign In for Pricing
View Details
Rabbit polyclonal Met antibody
MBS5304920-02 5x 0.05 mg

Rabbit polyclonal Met antibody

Sign In for Pricing
View Details
ATP6V1G3 siRNA (Mouse)
orb1834562-01 15 nmol

ATP6V1G3 siRNA (Mouse)

Sign In for Pricing
View Details
ATP6V1G3 siRNA (Mouse)
orb1834562-02 30 nmol

ATP6V1G3 siRNA (Mouse)

Sign In for Pricing
View Details
NEK2P3 Adenovirus (Human)
31705051 1.0 mL

NEK2P3 Adenovirus (Human)

Sign In for Pricing
View Details