Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Solanum lycopersicum Photosystem II 22 kDa protein, chloroplastic (PSBS)

This Recombinant Solanum lycopersicum Photosystem II 22 kDa protein, chloroplastic (PSBS) spans the amino acid sequence from region 68-276.

Product Specifications

Product Name Alternative

Photosystem II 22 kDa protein, chloroplastic, CP22

UniProt

P54773

Expression Region

68-276

Origin

Solanum lycopersicum (Tomato) (Lycopersicon esculentum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

APPKKVAPPKEKQKVEDGIFGTSGGIGFTKQNELFVGRVAMIGFAASLLGEAITGKGILA QLNLETGIPIYEAEPLLLFFILFNLLGAIGALGDRGKFVDDPTPPTGLEKAVIPPGKSFK SALGLSEGGPLFGFTKANELFVGRLAQLGIAFSIIGEIITGKGALAQLNFETGVPINEIE PLLLFNIAFFFFAAINPGTGKFITDEEED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL
BNC740437-500 1x 500 µL

CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF488A conjugate, 0.1mg/mL
BNC880175-100 1x 100 µL

CD46 (122.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF640R conjugate, 0.1mg/mL
BNC400861-500 1x 500 µL

HSP27 (G3.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL
BNC681820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF568 conjugate, 0.1mg/mL
BNC680160-500 1x 500 µL

CD20 (B9E9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF740 conjugate, 0.1mg/mL
BNC740871-100 1x 100 µL

CD71 (66IG10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details