Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Tetraspanin-31-B (tspan31-b)

This Recombinant Xenopus laevis Tetraspanin-31-B (tspan31-b) spans the amino acid sequence from region 1-212.

Product Specifications

Product Name Alternative

Tetraspanin-31-B, Tspan-31-B, Sarcoma-amplified sequence homolog B

UniProt

Q7ZWW7

Expression Region

1-212

Origin

Xenopus laevis (African clawed frog)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVCGGFTCSKNALCALNVVYMLVGVLLIIVAAWGKGFGIVSSIHIIGGVIAIGVFLLLIA IIGLIGAVSHHQVMLFIYMVVLILVFIFQFIVSCSCLAMNRSQQEYLLNTTWNRMSNETR LNLEKTLDCCGFLNTTEGRDEFKQDVALCIQVCSDPHKCPSCGDKMLNHADEALKILGGV GLFFSFTEILGVWLAFRYRNQKDPRANPSAFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP3 (3G3), CF568 conjugate, 0.1mg/mL
BNC680645-500 1x 500 µL

FOXP3 (3G3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF568 conjugate, 0.1mg/mL
BNC680391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF594 conjugate, 0.1mg/mL
BNC940525-100 1x 100 µL

CD63 (MX-49.129.5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF647 conjugate, 0.1mg/mL
BNC470152-500 1x 500 µL

CD11c (HC1/1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thyroglobulin (6E1.), CF405S conjugate, 0.1mg/mL
BNC040051-500 1x 500 µL

Thyroglobulin (6E1.), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFR (GFR1195), CF740 conjugate, 0.1mg/mL
BNC741195-100 1x 100 µL

EGFR (GFR1195), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details