Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Zea mays CASP-like protein 6

This Recombinant Zea mays CASP-like protein 6 spans the amino acid sequence from region 1-213.

Product Specifications

Product Name Alternative

CASP-like protein 6, Salicylic acid-induced protein 1-A

UniProt

B4FBQ7

Expression Region

1-213

Origin

Zea mays (Maize)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKMAEEKAAAVGGLGGAGAADAAQQQQLAAGEAAAARVRPVETLLRAAPLGLCVAAMTV MLRNQQSNEYGAVAYSDLGGFKYLVYANGLCAAYSLVSAFYTAVPRPATVSRSWLVFLLD QVFTYLILAAGAAAAELLYLAYNGDKEVTWSEACGVFGSFCRQARTSVAITFGTVLCFIL LSLISSYRLFSAYEAPPSSALGSKGVEIAAYPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Colon: right
CB627729 1 Block

Frozen Tissue Blocks, Colon: right

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS712821 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
GPR119 Antibody
8G125-AAT 50 µg

GPR119 Antibody

Sign In for Pricing
View Details
MFluor™ Blue 570-streptavidin conjugate
16935-AAT 100 µg

MFluor™ Blue 570-streptavidin conjugate

Sign In for Pricing
View Details
Pleconaril-d8 (Major)
TRC-P580352-1MG 1 mg

Pleconaril-d8 (Major)

Sign In for Pricing
View Details
Recombinant PRMT1 Antibody
RC-15213-01 50 μL

Recombinant PRMT1 Antibody

Sign In for Pricing
View Details