Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Atractaspis micropholis Cytochrome b (MT-CYB)

This Recombinant Atractaspis micropholis Cytochrome b (MT-CYB) spans the amino acid sequence from region 1-214.

Product Specifications

Product Name Alternative

Cytochrome b, Complex III subunit 3, Complex III subunit III, Cytochrome b-c1 complex subunit 3, Ubiquinol-cytochrome-c reductase complex cytochrome b subunit

UniProt

P87421

Expression Region

1-214

Origin

Atractaspis micropholis (Mole viper)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SINYXNMSNHHMLSTFNLLPVGSNISTWWNFGSMLMTCLALQTITGFFLAIHYTANINLA FSSIMHITRDIPYGWIMQNLHAIGASMFFVCIYIHIARGIYYGSYLNKEVWLSGVILLTA LMATAFFGYVLPWGQMSFWAATVITNLLTAIPYLGTMLTTWLWGGFSINDPTLTRFFALH FVLPFIIISMSSIHIILLHNEGSSNPLGTNSDID

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MYL12AP1 qPCR Primer Pair
QH66057S 200 Tests

Human MYL12AP1 qPCR Primer Pair

Sign In for Pricing
View Details
ASPER-29
HY-152210 1 Each

ASPER-29

Sign In for Pricing
View Details
Phospho-PDGFR beta (Tyr740) Antibody
MBS9600904-01 0.1 mL

Phospho-PDGFR beta (Tyr740) Antibody

Sign In for Pricing
View Details
Phospho-PDGFR beta (Tyr740) Antibody
MBS9600904-02 0.2 mL

Phospho-PDGFR beta (Tyr740) Antibody

Sign In for Pricing
View Details
Phospho-PDGFR beta (Tyr740) Antibody
MBS9600904-03 5x 0.2 mL

Phospho-PDGFR beta (Tyr740) Antibody

Sign In for Pricing
View Details
TCF4 sgRNA CRISPR Lentivector set (Human)
K2348901 3x 1.0 µg

TCF4 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details