Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staurastrum punctulatum Cytochrome b6 (petB)

This Recombinant Staurastrum punctulatum Cytochrome b6 (petB) spans the amino acid sequence from region 1-215.

Product Specifications

Product Name Alternative

Cytochrome b6

UniProt

Q32RU5

Expression Region

1-215

Origin

Staurastrum punctulatum (Green alga)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGKVYDWFEERLEIQAIADDVTNKYVPPHVNIFYCLGGIVFTSFIIQVATGFAMTFYYRP TVTEAFASVQYIMTEVNFGWLVRSVHRWSASMMVMTMILHIFRVYLTGGFKKPRELTWVT GVILSVLTVSFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVVGAPLVELLRGSVSVGQSTL TRFYSLHTFVLPLLTAVVMLMHFLMIRKQGISGPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG Immunoglobulin (IG266), CF405S conjugate, 0.1mg/mL
BNC040266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GnRH-Receptor (LHRH Receptor) (F1G4), CF488A conjugate, 0.1mg/mL
BNC880767-500 1x 500 µL

GnRH-Receptor (LHRH Receptor) (F1G4), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HCG-beta (Pregnancy & Choriocarcinoma Marker) (rHCGb/54), CF405S conjugate, 0.1mg/mL
BNC042197-500 1x 500 µL

HCG-beta (Pregnancy & Choriocarcinoma Marker) (rHCGb/54), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Vimentin (VM452), CF568 conjugate, 0.1mg/mL
BNC680452-100 1x 100 µL

Vimentin (VM452), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD14 (Monocyte / Macrophage Marker) (LPSR/2408), CF405S conjugate, 0.1mg/mL
BNC042408-100 1x 100 µL

CD14 (Monocyte / Macrophage Marker) (LPSR/2408), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 3 (KRT3) (Corneal Epithelial Marker) (KRT3/2130), CF740 conjugate, 0.1mg/mL
BNC742130-500 1x 500 µL

Cytokeratin 3 (KRT3) (Corneal Epithelial Marker) (KRT3/2130), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details