Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome b6 (petB)

This Recombinant Cytochrome b6 (petB) spans the amino acid sequence from region 1-215.

Product Specifications

Product Name Alternative

Cytochrome b6

UniProt

Q9TLZ7

Expression Region

1-215

Origin

Cyanidium caldarium

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKFYDWFQERLEIQLIADDISAKYVPPHVNVFYCFGGMTLTCFLVQLATGFAMTFYYKP TTIEAFSSIQHIMTQVSFGWLIRSLHRWSASMMVLMMILHIFRVYLTGGFKKPRELTWIT GVILAVLTVSFGVTGYSLPWDQVGYWACKIVTGVPEAIPVVGDNVVEILRGGTGVGQATL TRFYSLHTLFLPALSVIFLLAHFLMIRKQGISGPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DRD4, ID (D (2C) Dopamine Receptor, Dopamine D4 Receptor, D (4) Dopamine Receptor) (FITC) discontinued
D9000-18B-FITC 200 µL

DRD4, ID (D (2C) Dopamine Receptor, Dopamine D4 Receptor, D (4) Dopamine Receptor) (FITC) discontinued

Sign In for Pricing
View Details
ARPC4 Antibody
MBS9522917-01 0.04 mL

ARPC4 Antibody

Sign In for Pricing
View Details
ARPC4 Antibody
MBS9522917-02 0.1 mL

ARPC4 Antibody

Sign In for Pricing
View Details
ARPC4 Antibody
MBS9522917-03 0.2 mL

ARPC4 Antibody

Sign In for Pricing
View Details
ARPC4 Antibody
MBS9522917-04 5x 0.2 mL

ARPC4 Antibody

Sign In for Pricing
View Details
P16INK4A (CDKN2A) (NM_001195132) Human Over-expression Lysate
E45H00266-2 20 µg

P16INK4A (CDKN2A) (NM_001195132) Human Over-expression Lysate

Sign In for Pricing
View Details