Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Protease prsW (prsW)

This Recombinant Bacillus subtilis Protease prsW (prsW) spans the amino acid sequence from region 1-218.

Product Specifications

Product Name Alternative

Protease prsW, EC= 3.4.-.-, Protease responsible for activating sigma-W

UniProt

P50738

Expression Region

1-218

Origin

Bacillus subtilis (strain 168)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFAIISAGIAPGIALLSYFYLKDQYDNEPVHMVLRSFFLGVVLVFPIMFIQYVLEKENVG GGSFFVSFLSSGFLEESLKWFILMISVYPHAHFDEHYDGIVYGASVSLGFATLENILYLI GHGVEHAFVRALLPVSCHALIGVIMGFYLGKARFSADKARVKWLTLSLVVPSLLHGSYDF ILTALSNWIYYMLPFMVFLWWFGLRKAKKARSVNMMQV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDE9A (NM_001001583) Human Over-expression Lysate
LC424400 20 µg

PDE9A (NM_001001583) Human Over-expression Lysate

Sign In for Pricing
View Details
Formaldehyde 2,4-Dinitrophenylhydrazone-13C
TRC-F691401-1MG 1 mg

Formaldehyde 2,4-Dinitrophenylhydrazone-13C

Sign In for Pricing
View Details
Panobacumab Biosimilar - Research Grade
ICH5174-10mg 10 mg (2x 5 mg)

Panobacumab Biosimilar - Research Grade

Sign In for Pricing
View Details
Eph receptor A3 (EPHA3) Human Recombinant Protein
TP723965 100 µg

Eph receptor A3 (EPHA3) Human Recombinant Protein

Sign In for Pricing
View Details
HRPT2 (CDC73) Human Knockdown Lysate
LY300101 100 µg

HRPT2 (CDC73) Human Knockdown Lysate

Sign In for Pricing
View Details
Bcl-2 (BCL2/796), CF568 conjugate, 0.1mg/mL
BNC680796-100 1x 100 µL

Bcl-2 (BCL2/796), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details