Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Protease prsW (prsW)

This Recombinant Bacillus subtilis Protease prsW (prsW) spans the amino acid sequence from region 1-218.

Product Specifications

Product Name Alternative

Protease prsW, EC= 3.4.-.-, Protease responsible for activating sigma-W

UniProt

P50738

Expression Region

1-218

Origin

Bacillus subtilis (strain 168)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFAIISAGIAPGIALLSYFYLKDQYDNEPVHMVLRSFFLGVVLVFPIMFIQYVLEKENVG GGSFFVSFLSSGFLEESLKWFILMISVYPHAHFDEHYDGIVYGASVSLGFATLENILYLI GHGVEHAFVRALLPVSCHALIGVIMGFYLGKARFSADKARVKWLTLSLVVPSLLHGSYDF ILTALSNWIYYMLPFMVFLWWFGLRKAKKARSVNMMQV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Clobetasone 17-Butyrate
TRC-C583550-1G 1 g

Clobetasone 17-Butyrate

Sign In for Pricing
View Details
Recombinant Human Interleukin-4/IL-4 Protein
PKSH032650-01 20 µg

Recombinant Human Interleukin-4/IL-4 Protein

Sign In for Pricing
View Details
Recombinant Human Interleukin-4/IL-4 Protein
PKSH032650-02 100 µg

Recombinant Human Interleukin-4/IL-4 Protein

Sign In for Pricing
View Details
Histone H3 (mono methyl K56) Antibody
KC-356-01 50 μL

Histone H3 (mono methyl K56) Antibody

Sign In for Pricing
View Details
Histone H3 (mono methyl K56) Antibody
KC-356-02 100 µL

Histone H3 (mono methyl K56) Antibody

Sign In for Pricing
View Details
Histone H3 (mono methyl K56) Antibody
KC-356-03 1 mL

Histone H3 (mono methyl K56) Antibody

Sign In for Pricing
View Details