Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 125 (TMEM125)

This Recombinant Human Transmembrane protein 125 (TMEM125) spans the amino acid sequence from region 1-219.

Product Specifications

Product Name Alternative

Transmembrane protein 125

UniProt

Q96AQ2

Expression Region

1-219

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEQEAQAPGGRGLPPDMLAEQVELWWSQQPRRSALCFVVAVGLVAGCGAGGVALLSTTS SRSGEWRLATGTVLCLLALLVLVKQLMSSAVQDMNCIRQAHHVALLRSGGGADALVVLLS GLVLLVTGLTLAGLAAAPAPARPLAAMLSVGIALAALGSLLLLGLLLYQVGVSGHCPSIC MATPSTHSGHGGHGSIFSISGQLSAGRRHETTSSIASLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL
BNC401037-500 1x 500 µL

CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF488A conjugate, 0.1mg/mL
BNC880151-100 1x 100 µL

CD11a (Cris-3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF740 conjugate, 0.1mg/mL
BNC740449-500 1x 500 µL

CD104 (UM-A9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF568 conjugate, 0.1mg/mL
BNC680225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, pan (Cocktail PAN-CK), CF543 conjugate, 0.1mg/mL
BNC430999-500 1x 500 µL

Cytokeratin, pan (Cocktail PAN-CK), CF543 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX10 (Melanoma Marker) (rSOX10/1074), CF568 conjugate, 0.1mg/mL
BNC682312-500 1x 500 µL

SOX10 (Melanoma Marker) (rSOX10/1074), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details