Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlorobium tepidum ATP synthase subunit a 1 (atpB1)

This Recombinant Chlorobium tepidum ATP synthase subunit a 1 (atpB1) spans the amino acid sequence from region 1-221.

Product Specifications

Product Name Alternative

ATP synthase subunit a 1, ATP synthase F0 sector subunit a 1, F-ATPase subunit 6 1

UniProt

Q8KDL8

Expression Region

1-221

Origin

Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / TLS)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHLSSDEVILWQSGFLKLNLTIVTTWALMLLLAGGSALITRRLSTGITISRWQSMLEIIV TMAHRQISEVGLQKPEKYLPFIAALFLFIATANLCTVIPGYEPPTGSLSTTAALALSVFI AVPLFGIAESSLVGYLKTYAEPTPIMLPFNIVGELTRTMALAVRLFGNMMSGDMILVILL TISPLVFPVLMNILGLLTGMVQAYIFSILATVYIAAATRTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P27 / KIP1 (SX53G8), CF568 conjugate, 0.1mg/mL
BNC680669-100 1x 100 µL

P27 / KIP1 (SX53G8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF405S conjugate, 0.1mg/mL
BNC040806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF555 conjugate, 0.1mg/mL
BNC550039-100 1x 100 µL

CD34 (ICO-115), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF640R conjugate, 0.1mg/mL
BNC400029-100 1x 100 µL

Fibronectin (TV-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL
BNC040158-100 1x 100 µL

Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF488A conjugate, 0.1mg/mL
BNC880437-500 1x 500 µL

CD47 (B6H12.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details