Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_553757 (POPTRDRAFT_553757)

This Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_553757 (POPTRDRAFT_553757) spans the amino acid sequence from region 1-222.

Product Specifications

Product Name Alternative

CASP-like protein POPTRDRAFT_553757

UniProt

B9GXD6

Expression Region

1-222

Origin

Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGQKLAPAAEVAVQLPESKVAADNISGTMSGPLVGASGGGTTAAMRPFGRKAEVMHVLL RLLCIITSVAALSFMFTAQQSSTISIYGFMLPVQSKWSFSHSFEYLVGVSAAVAAHSLLQ LLISMSRLLRKSPVIPSRSHAWLIFAGDQVFAYAMISAGAAASGVTNLNRTGIQHTALPN FCKPLQSFCDHVAVSIFFTFTSCFLLAASAVQEVIWLSRSKY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NSUN5 (NM_148956) Human Over-expression Lysate
LC403452 20 µg

NSUN5 (NM_148956) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Myeloid tissue
CS630607 5x 5 µm

Frozen Tissue Sections, Myeloid tissue

Sign In for Pricing
View Details
Optitrol HEPA
SR12025 1 mL

Optitrol HEPA

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (C-Terminus) (rCLIP/1418), CF640R conjugate, 0.1mg/mL
BNC403176-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (C-Terminus) (rCLIP/1418), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SRD5A2L2 (TECRL) Human Gene Knockout Kit (CRISPR)
KN419868 1 Kit

SRD5A2L2 (TECRL) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD79b (B-Cell Marker) (IGB/2940R), CF568 conjugate, 0.1mg/mL
BNC682940-100 1x 100 µL

CD79b (B-Cell Marker) (IGB/2940R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details