Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_553757 (POPTRDRAFT_553757)

This Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_553757 (POPTRDRAFT_553757) spans the amino acid sequence from region 1-222.

Product Specifications

Product Name Alternative

CASP-like protein POPTRDRAFT_553757

UniProt

B9GXD6

Expression Region

1-222

Origin

Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGQKLAPAAEVAVQLPESKVAADNISGTMSGPLVGASGGGTTAAMRPFGRKAEVMHVLL RLLCIITSVAALSFMFTAQQSSTISIYGFMLPVQSKWSFSHSFEYLVGVSAAVAAHSLLQ LLISMSRLLRKSPVIPSRSHAWLIFAGDQVFAYAMISAGAAASGVTNLNRTGIQHTALPN FCKPLQSFCDHVAVSIFFTFTSCFLLAASAVQEVIWLSRSKY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NME2 Rabbit Monoclonal Antibody
TA423992 100 µL

NME2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Brain
CS712447 5x 5 µm

Tissue FFPE Sections, Brain

Sign In for Pricing
View Details
DLL4 Rabbit Polyclonal Antibody
ER1902-20 100 µL

DLL4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Actl9 Mouse Gene Knockout Kit (CRISPR)
KN500783 1 Kit

Actl9 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Mouse IL-1 beta/IL1B Protein
PKSM040957-01 20 µg

Recombinant Mouse IL-1 beta/IL1B Protein

Sign In for Pricing
View Details
Recombinant Mouse IL-1 beta/IL1B Protein
PKSM040957-02 100 µg

Recombinant Mouse IL-1 beta/IL1B Protein

Sign In for Pricing
View Details