Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_553757 (POPTRDRAFT_553757)

This Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_553757 (POPTRDRAFT_553757) spans the amino acid sequence from region 1-222.

Product Specifications

Product Name Alternative

CASP-like protein POPTRDRAFT_553757

UniProt

B9GXD6

Expression Region

1-222

Origin

Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGQKLAPAAEVAVQLPESKVAADNISGTMSGPLVGASGGGTTAAMRPFGRKAEVMHVLL RLLCIITSVAALSFMFTAQQSSTISIYGFMLPVQSKWSFSHSFEYLVGVSAAVAAHSLLQ LLISMSRLLRKSPVIPSRSHAWLIFAGDQVFAYAMISAGAAASGVTNLNRTGIQHTALPN FCKPLQSFCDHVAVSIFFTFTSCFLLAASAVQEVIWLSRSKY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGFR (Epidermal Growth Factor Receptor) (GFR/2341), CF640R conjugate, 0.1mg/mL
BNC402341-100 1x 100 µL

EGFR (Epidermal Growth Factor Receptor) (GFR/2341), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-Naphthyl Pyrovalerone-d8 Hydrochloride
TRC-N377702-1MG 1 mg

2-Naphthyl Pyrovalerone-d8 Hydrochloride

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF594 conjugate, 0.1mg/mL
BNC940178-500 1x 500 µL

CD50 (ICAM-3) (186-2G9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human FLG2 activation kit by CRISPRa
GA117991 1 Kit

Human FLG2 activation kit by CRISPRa

Sign In for Pricing
View Details
EGF Receptor Antibody
F40405-0.08ML 0.08 mL

EGF Receptor Antibody

Sign In for Pricing
View Details
TCF24 (NM_001193502) Human Recombinant Protein
TP331008L 1 mg

TCF24 (NM_001193502) Human Recombinant Protein

Sign In for Pricing
View Details