Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Putative cytochrome c-type biogenesis protein dbsD-like

This Recombinant Putative cytochrome c-type biogenesis protein dbsD-like spans the amino acid sequence from region 1-224.

Product Specifications

Product Name Alternative

Putative cytochrome c-type biogenesis protein dbsD-like

UniProt

Q1XDC3

Expression Region

1-224

Origin

Porphyra yezoensis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKLDLFVYNSQHFVNNITLYQLNHLNSTSFSFIFLSGLFTSLSPCIISILPVCILYIAGE TQKLNPINKTKNLFLFCLGTISSFITLGILATLITKTYSQFFNGIPTISAVVIIYMGLNL LNIVHINSPKFNGLVTNNNYNFKMYLSGVGIGIAISSCSTPIFVTLLVWINSTQKIFTGL IFILIYSIGYIFPIIIGSIFSTSFLKLTESLSGIIMAPSVELCY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit For Casein kinase I isoform alpha
E15507b 96 Tests

ELISA Kit For Casein kinase I isoform alpha

Sign In for Pricing
View Details
KIR3DL1 Rabbit Polyclonal Antibody (PE)
orb492197 100 µL

KIR3DL1 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
DGCR14 (C-9) : m-IgG Fc BP-HRP Bundle
sc-530813 1 Kit

DGCR14 (C-9) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
7-Methylindole-2-carboxylic acid
FM56788-01 2 g

7-Methylindole-2-carboxylic acid

Sign In for Pricing
View Details
7-Methylindole-2-carboxylic acid
FM56788-02 5 g

7-Methylindole-2-carboxylic acid

Sign In for Pricing
View Details
7-Methylindole-2-carboxylic acid
FM56788-03 10 g

7-Methylindole-2-carboxylic acid

Sign In for Pricing
View Details