Recombinant Rat CD9 antigen (Cd9)
This Recombinant Rat CD9 antigen (Cd9) spans the amino acid sequence from region 2-226.
Product Specifications
Product Name Alternative
CD9 antigen, CD_antigen= CD9
UniProt
P40241
Expression Region
2-226
Origin
Rattus norvegicus (Rat)
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
PVKGGSKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNHSSFYTGVYIL IGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAVWGYTHKDEVIKELQE FYKDTYQKLRNKDEPQRETLKAIHMALNCCGIAGGVEQFISDICPKKQVLESFQVKSCPD AIDEVFHSKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRSREMV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
1053001PE 0.1 mg
Rat IgG1 Isotype Control, R-PE Conjugated Antibody
Sign In for Pricing
View Details 
MBS6477678-01 0.1 mL
GCP 2 (Chemokine (CXC motif) ligand 6, Chemokine alpha 3, CKA3, CXCL6, Granulocyte chemotactic protein 2, SCYB6, Small inducible cytokine subfamily B (Cys X Cys) member 6) (PE)
Sign In for Pricing
View Details MBS6477678-02 5x 0.1 mL
GCP 2 (Chemokine (CXC motif) ligand 6, Chemokine alpha 3, CKA3, CXCL6, Granulocyte chemotactic protein 2, SCYB6, Small inducible cytokine subfamily B (Cys X Cys) member 6) (PE)
Sign In for Pricing
View Details RA21678-01 50 µL
Adducin α/β (phospho Ser726/713) Polyclonal Antibody
Sign In for Pricing
View Details