Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat CD9 antigen (Cd9)

This Recombinant Rat CD9 antigen (Cd9) spans the amino acid sequence from region 2-226.

Product Specifications

Product Name Alternative

CD9 antigen, CD_antigen= CD9

UniProt

P40241

Expression Region

2-226

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

PVKGGSKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNHSSFYTGVYIL IGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAVWGYTHKDEVIKELQE FYKDTYQKLRNKDEPQRETLKAIHMALNCCGIAGGVEQFISDICPKKQVLESFQVKSCPD AIDEVFHSKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRSREMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCL2L1 (Bcl-2-like Protein 1, Bcl2-L-1, Apoptosis Regulator Bcl-X, BCL2L, BCLX) (AP) discontinued
123882-AP 100 µL

BCL2L1 (Bcl-2-like Protein 1, Bcl2-L-1, Apoptosis Regulator Bcl-X, BCL2L, BCLX) (AP) discontinued

Sign In for Pricing
View Details
ABLIM2 Recombinant Protein (Mouse)
RP113561 100 µg

ABLIM2 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Compound Fr13512
orb3170077-01 1 mg

Compound Fr13512

Sign In for Pricing
View Details
Compound Fr13512
orb3170077-02 5 mg

Compound Fr13512

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Protein Kinase Inhibitor Beta (PKIb)
MBS2041338-01 0.1 mL

FITC-Linked Polyclonal Antibody to Protein Kinase Inhibitor Beta (PKIb)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Protein Kinase Inhibitor Beta (PKIb)
MBS2041338-02 0.2 mL

FITC-Linked Polyclonal Antibody to Protein Kinase Inhibitor Beta (PKIb)

Sign In for Pricing
View Details