Recombinant Triticum aestivum CASP-like protein STG (STG)
This Recombinant Triticum aestivum CASP-like protein STG (STG) spans the amino acid sequence from region 1-226.
Product Specifications
Product Name Alternative
CASP-like protein STG, Salt tolerence protein, TaSTG
UniProt
E6Y2A0
Expression Region
1-226
Origin
Triticum aestivum (Wheat)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSTSEAATVIPVYDVAPGQGAPSKAPAAAPPSAAAAAPAAAATTTAPRKFPMRFFRRSDR GSRCMAFLDFLLRIAAFGPALAAAIATGTSDETLSVFTEFFQFRARFDEFPAFLFLMVAS AIAAGYLLLSLPFSAVVVLRPQTTVLRLLLLVCDTIMLGLLTAGAAAAAAIVDLAHSGNE RANWVPICMQFHGFCRRTSGAVVASFLSVFIFVLLVVLAAFSIRKR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400008-100 1x 100 µL
MAGE A1 (MA454), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042580-100 1x 100 µL
CD10 (Membrane Metalloendopeptidase) (MME/2580), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882156-500 1x 500 µL
Catenin, gamma (Cardiomyocyte Marker) (rCTNG/1664), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401527-100 1x 100 µL
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1527), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details