Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype C subtype adr Small envelope protein (S)

This Recombinant Hepatitis B virus genotype C subtype adr Small envelope protein (S) spans the amino acid sequence from region 1-226.

Product Specifications

Product Name Alternative

Small envelope protein, S glycoprotein, S-HBsAg, SHB, Small S protein, Small surface protein

UniProt

P30019

Expression Region

1-226

Origin

Hepatitis B virus genotype C subtype adr (isolate China/NC-1/1988) (HBV-C)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNH SPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYHGMLPVCPLLPGTSTTSTGP CKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFV QWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4 Human Gene Knockout Kit (CRISPR)
KN206453 1 Kit

CD4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Adrenal gland
CS706968 5x 5 µm

Tissue FFPE Sections, Adrenal gland

Sign In for Pricing
View Details
2-(2-Cyclopropylethynyl)benzoic Acid
TRC-C986360-25G 25 g

2-(2-Cyclopropylethynyl)benzoic Acid

Sign In for Pricing
View Details
EMI1 (EMI1/1176), CF594 conjugate, 0.1mg/mL
BNC941176-100 1x 100 µL

EMI1 (EMI1/1176), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
9,17-Dihydroxycorticosterone 21-acetate
TRC-D323280-100MG 100 mg

9,17-Dihydroxycorticosterone 21-acetate

Sign In for Pricing
View Details
OR2T6 (C-term) Rabbit Polyclonal Antibody
AP53041PU-N 400 µL

OR2T6 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details