Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype C subtype adr Small envelope protein (S)

This Recombinant Hepatitis B virus genotype C subtype adr Small envelope protein (S) spans the amino acid sequence from region 1-226.

Product Specifications

Product Name Alternative

Small envelope protein, S glycoprotein, S-HBsAg, SHB, Small S protein, Small surface protein

UniProt

P30019

Expression Region

1-226

Origin

Hepatitis B virus genotype C subtype adr (isolate China/NC-1/1988) (HBV-C)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNH SPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYHGMLPVCPLLPGTSTTSTGP CKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFV QWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Prohibitin Monoclonal Antibody
AN301050L-01 50 µL

Recombinant Prohibitin Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Prohibitin Monoclonal Antibody
AN301050L-02 100 µL

Recombinant Prohibitin Monoclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: right
CS808073 5x 5 µm

Tissue FFPE Sections, Ovary: right

Sign In for Pricing
View Details
U0126
SIH-380-5MG 5 mg

U0126

Sign In for Pricing
View Details
Human XKR3 activation kit by CRISPRa
GA115735 1 Kit

Human XKR3 activation kit by CRISPRa

Sign In for Pricing
View Details
Human ZPLD1 activation kit by CRISPRa
GA115140 1 Kit

Human ZPLD1 activation kit by CRISPRa

Sign In for Pricing
View Details