Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dehalococcoides ethenogenes Glycerol-3-phosphate acyltransferase 5 (plsY5)

This Recombinant Dehalococcoides ethenogenes Glycerol-3-phosphate acyltransferase 5 (plsY5) spans the amino acid sequence from region 1-233.

Product Specifications

Product Name Alternative

Glycerol-3-phosphate acyltransferase 5, Acyl-PO4 G3P acyltransferase 5, Acyl-phosphate--glycerol-3-phosphate acyltransferase 5, G3P acyltransferase 5, GPAT 5, EC= 2.3.1.n3, Lys

UniProt

Q3Z643

Expression Region

1-233

Origin

Dehalococcoides ethenogenes (strain 195)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLVFIIMAIAGYLVGAIPMAYLLSRWRRGIDIRRYGSGNVGASNVVKTAGKRLGLAVFI FDVSKGAVMILLSGALGLALWQQIVVGLFTIAGHNWPVFLRFNGGRGIATSLGVALVMAP VPALIALGTAIAFGLFKKMAPGVFLGVAALPFMSGYFHGFFGIREYQTISWGFIGIFLIM VTRRLMAPDNEYAHTVSKAELIFNRMFLDRDIRSRSVWINRNSAPAEESPNIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 (PAb122), CF405S conjugate, 0.1mg/mL
BNC040338-500 1x 500 µL

P53 (PAb122), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF640R conjugate, 0.1mg/mL
BNC400338-100 1x 100 µL

P53 (PAb122), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF488A conjugate, 0.1mg/mL
BNC880040-500 1x 500 µL

CD35 / CR1 (E11), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytochrome C (Mitochondrial Marker) (7H8.2C12), CF647 conjugate, 0.1mg/mL
BNC470183-500 1x 500 µL

Cytochrome C (Mitochondrial Marker) (7H8.2C12), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ubiquitin (Autophagy Marker) (UBB/2122), CF568 conjugate, 0.1mg/mL
BNC682122-500 1x 500 µL

Ubiquitin (Autophagy Marker) (UBB/2122), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (VP2897R), CF640R conjugate, 0.1mg/mL
BNC402897-100 1x 100 µL

Major Vault Protein (MVP) (VP2897R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details