Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus gordonii ATP synthase subunit a (atpB)

This Recombinant Streptococcus gordonii ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-237.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A8AYG6

Expression Region

1-237

Origin

Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEESVNPTIQLGPVTFNLTLLAMSLLAVLLVFAFVYWASRKMTLKPSGKQNALEYLYDFV IDFTKGNIGSKYMKNYSLFLFSLFLFLVVANNLGLMAKLQTTSGENLWTSPTANIAFDLS MSFLITLICHVEGIRRRGFKKYLKAFVTPGFMTPMNILEEFTNFASLALRIYGNIFAGEV LSGLLVTLSHQAVFYYPLAFGLNLVWTAFSVFISCVQAYVFTMLTSMYLGKKINGEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human UHRF1BP1 activation kit by CRISPRa
GA110344 1 Kit

Human UHRF1BP1 activation kit by CRISPRa

Sign In for Pricing
View Details
SLC22A8 (NM_004254) Human Over-expression Lysate
LY401365 100 µg

SLC22A8 (NM_004254) Human Over-expression Lysate

Sign In for Pricing
View Details
Daprodustat Bishydroxylated Metabolite
TRC-D193370-2.5MG 2.5 mg

Daprodustat Bishydroxylated Metabolite

Sign In for Pricing
View Details
Tbc1d8 Mouse Gene Knockout Kit (CRISPR)
KN517259 1 Kit

Tbc1d8 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD38 Antibody
KC-862-01 50 μL

CD38 Antibody

Sign In for Pricing
View Details
CD38 Antibody
KC-862-02 100 µL

CD38 Antibody

Sign In for Pricing
View Details