Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Membrane protein insertase YidC 1 (yidC1)

This Recombinant Membrane protein insertase YidC 1 (yidC1) spans the amino acid sequence from region 23-260.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC 1, Foldase YidC 1, Membrane integrase YidC 1, Membrane protein YidC 1

UniProt

Q81XH4

Expression Region

23-260

Origin

Bacillus anthracis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CSNATPIDAHSTGIWDHYFVYPISFMIQFVAHHIPGASFGIAIIIMTLVIRSAMIPLAVS QYRSQAKMKKMQPELQKLKQKYGDVSKDLEKQKQYQKEMSELMKSGGWNPLAGCWPLLIQ MPIFSALYYAISRTEEIRTSTFLWVNLGHADPYHILPIIAALTTFIQMKVFQSNSTSGEQ VQMLKMQQIMMPAMILFMGFAAPSGLVLYWITGNLFTMMQTIVLRKIMEREELQLQKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Histone Cluster 2, H2ac (HIST2H2AC)
TRV-0011997-01 10 µg

Recombinant Histone Cluster 2, H2ac (HIST2H2AC)

Sign In for Pricing
View Details
Recombinant Histone Cluster 2, H2ac (HIST2H2AC)
TRV-0011997-02 50 µg

Recombinant Histone Cluster 2, H2ac (HIST2H2AC)

Sign In for Pricing
View Details
Recombinant Histone Cluster 2, H2ac (HIST2H2AC)
TRV-0011997-03 100 µg

Recombinant Histone Cluster 2, H2ac (HIST2H2AC)

Sign In for Pricing
View Details
Recombinant Histone Cluster 2, H2ac (HIST2H2AC)
TRV-0011997-04 200 µg

Recombinant Histone Cluster 2, H2ac (HIST2H2AC)

Sign In for Pricing
View Details
Recombinant Histone Cluster 2, H2ac (HIST2H2AC)
TRV-0011997-05 500 µg

Recombinant Histone Cluster 2, H2ac (HIST2H2AC)

Sign In for Pricing
View Details
Recombinant Histone Cluster 2, H2ac (HIST2H2AC)
TRV-0011997-06 1 mg

Recombinant Histone Cluster 2, H2ac (HIST2H2AC)

Sign In for Pricing
View Details