Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pyogenes serotype M5 ATP synthase subunit a (atpB)

This Recombinant Streptococcus pyogenes serotype M5 ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-238.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A2RFC7

Expression Region

1-238

Origin

Streptococcus pyogenes serotype M5 (strain Manfredo)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEEAKIPMLELGPITFNLTLLAVCIVTIAVIFAFVFWASRQMKLKPEGKQTALEYLISFV DGIGEEHLDHNLQKSYSLLLFTIFLFVAVANNLGLFTKLETVNGYNLWTSPTANLAFDLA LSLFITLMVHIEGVRRRGLVAHLKRLATPWPMTPMNLLEEFTNFLSLAIRLFGNIFAGEV VTGLIVQLANYRVYWWPIAFLVNMAWTAFSVFISCIQAFVFTKLTATYLGKKVNESEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4- (2,4-Dichlorophenyl) piperidine
GFB77171-01 50 mg

4- (2,4-Dichlorophenyl) piperidine

Sign In for Pricing
View Details
4- (2,4-Dichlorophenyl) piperidine
GFB77171-02 0.5 g

4- (2,4-Dichlorophenyl) piperidine

Sign In for Pricing
View Details
mPEG-SC, 550
MF001023-550-01 1 g

mPEG-SC, 550

Sign In for Pricing
View Details
mPEG-SC, 550
MF001023-550-02 5 g

mPEG-SC, 550

Sign In for Pricing
View Details
TTLL6 Human shRNA Lentiviral Particle (Locus ID 284076)
TL300748V 500 µL Each

TTLL6 Human shRNA Lentiviral Particle (Locus ID 284076)

Sign In for Pricing
View Details
Protein NDRG1 (NDRG1) Human ELISA Kit
G3729 96 Tests

Protein NDRG1 (NDRG1) Human ELISA Kit

Sign In for Pricing
View Details