Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Tetraspanin-9 (TSPAN9)

This Recombinant Sheep Tetraspanin-9 (TSPAN9) spans the amino acid sequence from region 1-239.

Product Specifications

Product Name Alternative

Tetraspanin-9, Tspan-9, Tetraspan NET-5

UniProt

B3VSC2

Expression Region

1-239

Origin

Ovis aries (Sheep)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MARGCLCCLKYAMFLFNLIFWLCGCGLLGVGIWLSVSQGNFATFSPSFPSLSAANLVIAI GTIVMVTGFLGCLGAIKENRCLLLSFFIVLLIILLAELILIILFFVYMDKVNENAKKDLK EGLLLYNSENNVGLKNAWNIIQAEMHCCGVTDYRDWFLVLGENTVPDRCCMENSQGCGQN NTTLLWRTGCYEKVKQWFADNKHVLGTVGMCLLITQILGMAFSMTLFQHIHRTGKKYDA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Claudin 6 Antibody
orb1333494 100 µg

Claudin 6 Antibody

Sign In for Pricing
View Details
TREX1 (Three Prime Repair Exonuclease 1, AGS1, AGS5, CRV, DKFZp434J0310, DRN3, HERNS) (APC)
MBS6451785-01 0.1 mL

TREX1 (Three Prime Repair Exonuclease 1, AGS1, AGS5, CRV, DKFZp434J0310, DRN3, HERNS) (APC)

Sign In for Pricing
View Details
TREX1 (Three Prime Repair Exonuclease 1, AGS1, AGS5, CRV, DKFZp434J0310, DRN3, HERNS) (APC)
MBS6451785-02 5x 0.1 mL

TREX1 (Three Prime Repair Exonuclease 1, AGS1, AGS5, CRV, DKFZp434J0310, DRN3, HERNS) (APC)

Sign In for Pricing
View Details
Mouse Monoclonal RhoD Antibody (OTI2F7) [PE/Cy5.5]
NBP2-73889PECY55 0.1 mL

Mouse Monoclonal RhoD Antibody (OTI2F7) [PE/Cy5.5]

Sign In for Pricing
View Details
NEUROD6 Peptide
MBS3225960-01 0.1 mg

NEUROD6 Peptide

Sign In for Pricing
View Details
NEUROD6 Peptide
MBS3225960-02 5x 0.1 mg

NEUROD6 Peptide

Sign In for Pricing
View Details