Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus ATP synthase subunit a (atpB)

This Recombinant Prochlorococcus marinus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q7V5S2

Expression Region

1-241

Origin

Prochlorococcus marinus (strain MIT 9313)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGFLPIALPFAELEVGQHLYWQIGNLQLHGQVFMTSWIVIGAILALVVVGTRKMERDPHG VQNLLEFLWDYIRDLARTQIGEKAYRDWMPFIGTLFLFIFVSNWGGSLVPWKLIHLPSGE LGAPTADINTTVALALLVSLSYFYAGLSRKGLRYFEYYVHPTPIMIPFKIVEDFTKPLSL SFRLFGNILADELVVAVLVFLVPLFLPVPVMFLGLFTSAIQALIFATLAAYYIGEAVEEH H

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RELA (Transcription Factor p65, Nuclear Factor NF-kappa-B p65 Subunit, Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B Cells 3, NFKB3, MGC131774) (MaxLight 405) discontinued
132465-ML405 100 µL

RELA (Transcription Factor p65, Nuclear Factor NF-kappa-B p65 Subunit, Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B Cells 3, NFKB3, MGC131774) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Anti-Phospho-EIF5 (Ser389, 390) Polyclonal Antibody
TMAC-01280-01 50 μL

Anti-Phospho-EIF5 (Ser389, 390) Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Phospho-EIF5 (Ser389, 390) Polyclonal Antibody
TMAC-01280-02 100 µL

Anti-Phospho-EIF5 (Ser389, 390) Polyclonal Antibody

Sign In for Pricing
View Details
RAB11A polyclonal antibody
orb646382-01 50 μL

RAB11A polyclonal antibody

Sign In for Pricing
View Details
RAB11A polyclonal antibody
orb646382-02 100 µL

RAB11A polyclonal antibody

Sign In for Pricing
View Details
RAB11A polyclonal antibody
orb646382-03 200 µL

RAB11A polyclonal antibody

Sign In for Pricing
View Details