Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Populus trichocarpa Casparian strip membrane protein POPTRDRAFT_767048 (POPTRDRAFT_767048)

This Recombinant Populus trichocarpa Casparian strip membrane protein POPTRDRAFT_767048 (POPTRDRAFT_767048) spans the amino acid sequence from region 1-243.

Product Specifications

Product Name Alternative

Casparian strip membrane protein POPTRDRAFT_767048

UniProt

B9HQ42

Expression Region

1-243

Origin

Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPIYINHILPWHSITNKLSSPDHYLLAMDVSDKSGEATKITIQEPKADTKGKGIAGALT APVVVAAKAAQRPRKGWKKGAAIFDLTLRLSAIAAGFAATSLMATTDQTLPFFTQFFQFH AQYTDLPTFLSFMIVNAITSGYLVLSLPFSIVCIVRARAAGPRLLLIILDSVMMALTTSA ASASAAIVYLAHNGNSSSNWNAFCQQFNNYCQQVSNAVVASFLAAALLLSLVVLSAFALR KMK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Leptin, LEP ELISA Kit
CSB-E14936Mk-01 96 Tests

Monkey Leptin, LEP ELISA Kit

Sign In for Pricing
View Details
Monkey Leptin, LEP ELISA Kit
CSB-E14936Mk-02 5x 96 Tests

Monkey Leptin, LEP ELISA Kit

Sign In for Pricing
View Details
Monkey Leptin, LEP ELISA Kit
CSB-E14936Mk-03 10x 96 Tests

Monkey Leptin, LEP ELISA Kit

Sign In for Pricing
View Details
(3-Chlorophenyl) [3- (difluoromethoxy) phenyl]methanone
MTC95876-01 50 mg

(3-Chlorophenyl) [3- (difluoromethoxy) phenyl]methanone

Sign In for Pricing
View Details
(3-Chlorophenyl) [3- (difluoromethoxy) phenyl]methanone
MTC95876-02 0.5 g

(3-Chlorophenyl) [3- (difluoromethoxy) phenyl]methanone

Sign In for Pricing
View Details
SPHK1 Human Over-expression Lysate
orb1354847 100 µg

SPHK1 Human Over-expression Lysate

Sign In for Pricing
View Details