Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas syringae pv. tomato Cobalamin synthase (cobS)

This Recombinant Pseudomonas syringae pv. tomato Cobalamin synthase (cobS) spans the amino acid sequence from region 1-243.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q885W4

Expression Region

1-243

Origin

Pseudomonas syringae pv. tomato (strain DC3000)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLPFWIALQFLGSLPIRLPGMPRPAELGRSLLFYPLVGVVFGTLLLGFNALLSGAPLLLH AALLLSAWVLLSGGLHLDGLADSADAWLGGFGDRERTLNIMKDPRSGPIAVVTLVVVLLL KFAAIVALIESHNSIGLLLAPLIGRSAMLALFLGTPYVRSGGLGQALADHLPRSLGRKVL LVSTVACVVLAGWSGIAALLVCAVCFYWLRHMMMRRLGGSTGDTAGALLELLELAVVLTL ALL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OTUD4 (NM_001102653) Human Over-expression Lysate
LC420180 20 µg

OTUD4 (NM_001102653) Human Over-expression Lysate

Sign In for Pricing
View Details
1,3-Benzodioxole-N-phthalimido DL-threo-Droxidopa
TRC-B203500-50MG 50 mg

1,3-Benzodioxole-N-phthalimido DL-threo-Droxidopa

Sign In for Pricing
View Details
Nat8f5 Mouse Gene Knockout Kit (CRISPR)
KN503518 1 Kit

Nat8f5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RAD51 Human Gene Knockout Kit (CRISPR)
KN400692 1 Kit

RAD51 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CA5B Antibody
8C14942-AAT 50 µg

CA5B Antibody

Sign In for Pricing
View Details
AccuOrangeTM Protein Quantitation Kit, 2000 assays
#30071 1 Kit

AccuOrangeTM Protein Quantitation Kit, 2000 assays

Sign In for Pricing
View Details