Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Laribacter hongkongensis Cobalamin synthase (cobS)

This Recombinant Laribacter hongkongensis Cobalamin synthase (cobS) spans the amino acid sequence from region 1-244.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

C1D6F9

Expression Region

1-244

Origin

Laribacter hongkongensis (strain HLHK9)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRSLILAVQFLTRLPTPQLRTFDPAWLAGAIRWFAVVGLLVGALVAALGWLGAWLDPWLA ALLMLVTWVWVTGGLHLDGLGDLADGLGAAHRSPERFLAVLKDPHTGSFAVITLALQLLA KLVLLMLAVRHGVGWSALVLLPAWARLGAVWWTTLPPLSAGGHAERFAWRHDWPAFWLSW LLLAALSAWLAPVLLLAPVLWWGWRRFLWRRLGGMSGDCLGAGIELTETGLLLLAVVATR LPLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDE6 gamma (PDE6G) (NM_002602) Human Over-expression Lysate
LY419220 100 µg

PDE6 gamma (PDE6G) (NM_002602) Human Over-expression Lysate

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (HMPV), CF640R conjugate, 0.1mg/mL
BNC400954-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (HMPV), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RHOB Human Gene Knockout Kit (CRISPR)
KN209837 1 Kit

RHOB Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PCSK9 Human Gene Knockout Kit (CRISPR)
KN220000BN 1 Kit

PCSK9 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human IL13 activation kit by CRISPRa
GA102405 1 Kit

Human IL13 activation kit by CRISPRa

Sign In for Pricing
View Details
ABCE1 (NM_001040876) Human Over-expression Lysate
LC420840 20 µg

ABCE1 (NM_001040876) Human Over-expression Lysate

Sign In for Pricing
View Details