Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella boydii serotype 18 Cobalamin synthase (cobS)

This Recombinant Shigella boydii serotype 18 Cobalamin synthase (cobS) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B2TWQ9

Expression Region

1-247

Origin

Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKLFWAMLSFITRLPVPRRWSQGLDFEHYSRGIITFPLIGLLLGAISGLVFMVLQAWCG VPLAALFSVLVLALMTGGFHLDGLADTCDGVFSARSRDRMLEIMRDSRLGTHGGLALIFV VLAKILVLSELALRGEPILASLAAACAVSRGTAALLMYRHRYAREEGLGNVFIGKIDGRQ TCVTLGLAAIFAAVLLPGMHGVAAMVVTMVAIFILGQLLKRTLGGQTGDTLGAAIELGEL VFLLALL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

A-Myb Lentiviral Activation Particles (h)
sc-404328-LAC 200 µL

A-Myb Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Cyclophilin B (CYPB) BioAssayTM ELISA Kit (Rabbit) discontinued
024513-01 48 Tests

Cyclophilin B (CYPB) BioAssayTM ELISA Kit (Rabbit) discontinued

Sign In for Pricing
View Details
Cyclophilin B (CYPB) BioAssayTM ELISA Kit (Rabbit) discontinued
024513-02 96 Tests

Cyclophilin B (CYPB) BioAssayTM ELISA Kit (Rabbit) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal TBC1D4 Antibody (OTI5E6) [PE/Cy5.5]
NBP2-74462PECY55 0.1 mL

Mouse Monoclonal TBC1D4 Antibody (OTI5E6) [PE/Cy5.5]

Sign In for Pricing
View Details
Rabbit Polyclonal KCTD20 Antibody
NBP1-86738-25ul 25 µL

Rabbit Polyclonal KCTD20 Antibody

Sign In for Pricing
View Details
Fuca1 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6813303 1.0 µg DNA

Fuca1 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details