Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Morus indica ATP synthase subunit a, chloroplastic (atpI)

This Recombinant Morus indica ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

Q09X29

Expression Region

1-247

Origin

Morus indica (Mulberry)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVLLCSINTLKGLYDISGVEVGQHLYWKIGGFQVHAQVLITSWVVIAILLGSSIIAVRN PQTIPTDGQNFFEYVLEFIRDVSRTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII QLPHGELAAPTNDINTTVALALLTSVAYFYAGLTKKGLGYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KHK antibody
MBS832550-01 0.1 mL

KHK antibody

Sign In for Pricing
View Details
KHK antibody
MBS832550-02 5x 0.1 mL

KHK antibody

Sign In for Pricing
View Details
KDELC2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
25464111 3x 1.0 µg

KDELC2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Cmtm4 (NM_153582) Mouse Tagged ORF Clone
MG202216 10 µg

Cmtm4 (NM_153582) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human Neuronatin (NNAT) activation kit by CRISPRa
GA103219 1 Kit

Human Neuronatin (NNAT) activation kit by CRISPRa

Sign In for Pricing
View Details
RPL7AP26 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV775268 1.0 µg DNA

RPL7AP26 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details