Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ranunculus macranthus ATP synthase subunit a, chloroplastic (atpI)

This Recombinant Ranunculus macranthus ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

Q4FGF5

Expression Region

1-247

Origin

Ranunculus macranthus (Large buttercup)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVLPCSVNTLKGLYDISGVEVGQHFYWQIGGFQVHAQVLITSWFVIAILLGSAIIAVRN PQTIPTDGQNFFEYVLEFIRDLSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII QLPHGELAAPTNDINTTVALALPTSVAYFYAGLTKKGLGYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPSVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLK14 Protein Vector (Human) (pPM-C-HA)
PV089292 500 ng

KLK14 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
TJP2 (NM_004817) Human Tagged ORF Clone Lentiviral Particle
RC205295L4V 200 µL

TJP2 (NM_004817) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Csk (Phospho-Ser364) Phospho Sandwich ELISA Kit
MBS9511020-01 1 Kit

Csk (Phospho-Ser364) Phospho Sandwich ELISA Kit

Sign In for Pricing
View Details
Csk (Phospho-Ser364) Phospho Sandwich ELISA Kit
MBS9511020-02 5x 1 Kit

Csk (Phospho-Ser364) Phospho Sandwich ELISA Kit

Sign In for Pricing
View Details
ASRGL1 (Isoaspartyl Peptidase/L-asparaginase, Asparaginase-like Protein 1, Beta-aspartyl-peptidase, Isoaspartyl dipeptidase, L-asparagine Amidohydrolase, ALP, CRASH, FLJ22316) discontinued
151183 100 µg

ASRGL1 (Isoaspartyl Peptidase/L-asparaginase, Asparaginase-like Protein 1, Beta-aspartyl-peptidase, Isoaspartyl dipeptidase, L-asparagine Amidohydrolase, ALP, CRASH, FLJ22316) discontinued

Sign In for Pricing
View Details
Recombinant Human ASGR1 Protein, N-Fc
orb2834180-01 20 µg

Recombinant Human ASGR1 Protein, N-Fc

Sign In for Pricing
View Details