Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. ATP synthase subunit a (atpB)

This Recombinant Synechococcus sp. ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q2JIF4

Expression Region

1-248

Origin

Synechococcus sp. (strain JA-2-3B'a (2-13) ) (Cyanobacteria bacterium Yellowstone B-Prime)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLSFSSPPLLAELEVGHHLYWHLGKFTVHGQVLIASWIAIALILTVVILGTRQLQREPA GLQNFVEYALEFVQSIARAQIGEKNFRPWVPYVGTLFLFIFVSNWMGNLFPWKLIPLPEG ELASPTNDINTTAGLALLTSIMYFVAGISKRGLSYFKKYIEPTPILLPINVLEDFTKPLS LSFRLFGNILAEELVIAVLVLLVPLFIPVPVMVLFLFTGAIQALIFSTLSAAYIGEALEG HGGGDHRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AICAR transformylase CRISPR Activation Plasmid (m)
sc-430823-ACT 20 µg

AICAR transformylase CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
GPR43 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-23786R-BF750 100 µL

GPR43 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Recombinant Mycobacterium Gilvum ribH Protein (aa 1-159)
VAng-Yyj4268-50gEcoli 50 µg (E. coli)

Recombinant Mycobacterium Gilvum ribH Protein (aa 1-159)

Sign In for Pricing
View Details
Bortezomib impurity 76
IB181070-01 5 mg

Bortezomib impurity 76

Sign In for Pricing
View Details
Bortezomib impurity 76
IB181070-02 10 mg

Bortezomib impurity 76

Sign In for Pricing
View Details
Bortezomib impurity 76
IB181070-03 25 mg

Bortezomib impurity 76

Sign In for Pricing
View Details