Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Protein YIPF4 (YIPF4)

This Recombinant Chicken Protein YIPF4 (YIPF4) spans the amino acid sequence from region 1-249.

Product Specifications

Product Name Alternative

Protein YIPF4, YIP1 family member 4

UniProt

Q5ZJD7

Expression Region

1-249

Origin

Gallus gallus (Chicken)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQPPGPQQPPPPPLFTPNNGDFTFVSSADAEDPSGSITTPDVKLNLGGEFIKESSATTFL RQRGYGWLLEVEDDDPEDNKPLLEELDIDLKDIYYKIRCVLMPMPSLGFNRQVVRDNPDF WGPLAVVLFFSMISLYGQFKVVSWIITIWIFGSLTIFLLARVLGGEVAYGQVLGVIGYSL LPLIVIAPVLLVVGSFEVVSTLIKLFGVFWAAYSAASLLVGEEFKTKKPLLIYPIFLLYI YFLSLYTGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EMILIN3 (NM_052846) Human Tagged ORF Clone
RC216328 10 µg

EMILIN3 (NM_052846) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae Uncharacterized protein HI_0096 (HI_0096), partial
MBS7060717 Inquire

Recombinant Haemophilus influenzae Uncharacterized protein HI_0096 (HI_0096), partial

Sign In for Pricing
View Details
MYL7 Rabbit Polyclonal Antibody (Cy5.5)
orb1016770 100 µL

MYL7 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
Human HDX (NM_001177479) AAV Particle
RC230433A1V 250 µL

Human HDX (NM_001177479) AAV Particle

Sign In for Pricing
View Details
Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 (AGAP3) Human ELISA Kit
B6582 96 Tests

Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 (AGAP3) Human ELISA Kit

Sign In for Pricing
View Details
Rga2 Antibody
orb855723 2 mg

Rga2 Antibody

Sign In for Pricing
View Details