Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus suis Membrane protein insertase YidC (yidC)

This Recombinant Streptococcus suis Membrane protein insertase YidC (yidC) spans the amino acid sequence from region 21-270.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC, Foldase YidC, Membrane integrase YidC, Membrane protein YidC

UniProt

A4W485

Expression Region

21-270

Origin

Streptococcus suis (strain 98HAH33)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CGTGPVTSQSTDAWDRLIYWFASIIQFLSINGQIGIGIILFTILIRTLLLPLFQIQMNSS RKMQELQPQLKKLQAEYPGTDMESRQQLYEATQALYKENGVSMRASMIPLFIQMPILLAL FQALTRVEALKVGHFLWLNLGEPDPFFILPILAAVFTFLSSWLTNKSAIEKNMAMTIMTY VMPVMIFFFAVAAASGVALYWTVSNAYQVAQTLVFNNPFKIIAERQAKIDAEKERQAKIR RAQKKAQKKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCF12 Rabbit Polyclonal Antibody (BF750)
orb2546322 100 µL

TCF12 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Recombinant Human DLC1 Protein
E30P8183 20 µg

Recombinant Human DLC1 Protein

Sign In for Pricing
View Details
FSTL1 (NM_007085) Human Recombinant Protein
TP721135M 50 µg

FSTL1 (NM_007085) Human Recombinant Protein

Sign In for Pricing
View Details
Zfp692 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7579208 1.0 µg DNA

Zfp692 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Lentiviral mouse A430005L14Rik shRNA (UAS) - Lentiviral mouse A430005L14Rik shRNA (UAS, iRFP) (25)
GTR15223334 1 Vial

Lentiviral mouse A430005L14Rik shRNA (UAS) - Lentiviral mouse A430005L14Rik shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
CD40 Antibody
MBS8587095-01 0.1 mg

CD40 Antibody

Sign In for Pricing
View Details