Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus suis Membrane protein insertase YidC (yidC)

This Recombinant Streptococcus suis Membrane protein insertase YidC (yidC) spans the amino acid sequence from region 21-270.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC, Foldase YidC, Membrane integrase YidC, Membrane protein YidC

UniProt

A4W485

Expression Region

21-270

Origin

Streptococcus suis (strain 98HAH33)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CGTGPVTSQSTDAWDRLIYWFASIIQFLSINGQIGIGIILFTILIRTLLLPLFQIQMNSS RKMQELQPQLKKLQAEYPGTDMESRQQLYEATQALYKENGVSMRASMIPLFIQMPILLAL FQALTRVEALKVGHFLWLNLGEPDPFFILPILAAVFTFLSSWLTNKSAIEKNMAMTIMTY VMPVMIFFFAVAAASGVALYWTVSNAYQVAQTLVFNNPFKIIAERQAKIDAEKERQAKIR RAQKKAQKKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP1 Antibody
MBS9232710-01 0.1 mL

MMP1 Antibody

Sign In for Pricing
View Details
MMP1 Antibody
MBS9232710-02 5x 0.1 mL

MMP1 Antibody

Sign In for Pricing
View Details
ICCA CRISPR Knock Out 293T Cell Line (Human)
24151141 1x 10^6 Cells / 1.0 mL

ICCA CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Mouse Monoclonal CFTR Antibody (CFTR/1341) [PE]
NBP2-54506PE 0.1 mL

Mouse Monoclonal CFTR Antibody (CFTR/1341) [PE]

Sign In for Pricing
View Details
PFDN4 Protein Vector (Mouse) (pPM-C-HA)
36427025 500 ng

PFDN4 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Zfp759 Mouse shRNA Plasmid (Locus ID 268670)
TR516631 1 Kit

Zfp759 Mouse shRNA Plasmid (Locus ID 268670)

Sign In for Pricing
View Details