Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus suis Membrane protein insertase YidC (yidC)

This Recombinant Streptococcus suis Membrane protein insertase YidC (yidC) spans the amino acid sequence from region 21-270.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC, Foldase YidC, Membrane integrase YidC, Membrane protein YidC

UniProt

A4W485

Expression Region

21-270

Origin

Streptococcus suis (strain 98HAH33)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CGTGPVTSQSTDAWDRLIYWFASIIQFLSINGQIGIGIILFTILIRTLLLPLFQIQMNSS RKMQELQPQLKKLQAEYPGTDMESRQQLYEATQALYKENGVSMRASMIPLFIQMPILLAL FQALTRVEALKVGHFLWLNLGEPDPFFILPILAAVFTFLSSWLTNKSAIEKNMAMTIMTY VMPVMIFFFAVAAASGVALYWTVSNAYQVAQTLVFNNPFKIIAERQAKIDAEKERQAKIR RAQKKAQKKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTHFD1L Antibody
orb40813-01 50 μL

MTHFD1L Antibody

Sign In for Pricing
View Details
MTHFD1L Antibody
orb40813-02 100 µL

MTHFD1L Antibody

Sign In for Pricing
View Details
Phospho-NFKB p65 (Ser281) Polyclonal Antibody, APC-Cy7 Conjugated
bs-17502R-APC-Cy7 100 µL

Phospho-NFKB p65 (Ser281) Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
SRT2104 5mg
A14188-5 5 mg

SRT2104 5mg

Sign In for Pricing
View Details
MLYCD HDR Plasmid (h)
sc-411738-HDR 20 µg

MLYCD HDR Plasmid (h)

Sign In for Pricing
View Details
Porcine Calprotectin (CALP) ELISA Kit
YP-W80052-01 48 Tests

Porcine Calprotectin (CALP) ELISA Kit

Sign In for Pricing
View Details