Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit a (atpB)

This Recombinant ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-250.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

P63655

Expression Region

1-250

Origin

Mycobacterium bovis

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTETILAAQIEVGEHHTATWLGMTVNTDTVLSTAIAGLIVIALAFYLRAKVTSTDVPGGV QLFFEAITIQMRNQVESAIGMRIAPFVLPLAVTIFVFILISNWLAVLPVQYTDKHGHTTE LLKSAAADINYVLALALFVFVCYHTAGIWRRGIVGHPIKLLKGHVTLLAPINLVEEVAKP ISLSLRLFGNIFAGGILVALIALFPPYIMWAPNAIWKAFDLFVGAIQAFIFALLTILYFS QAMELEEEHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse AU018091 shRNA (UAS) - Lentiviral mouse AU018091 shRNA (UAS, RFP) (100)
GTR15231792 1 Vial

Lentiviral mouse AU018091 shRNA (UAS) - Lentiviral mouse AU018091 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Lentiviral human ZNF430 sgRNA gene knockout kit - Lentiviral human ZNF430 sgRNA gene knockout kit (plasmid)
GTR15368675 1 Vial

Lentiviral human ZNF430 sgRNA gene knockout kit - Lentiviral human ZNF430 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Monoclonal Antibody to Complement Component 3a (C3a)
TRV-0033481-01 20 µL

Monoclonal Antibody to Complement Component 3a (C3a)

Sign In for Pricing
View Details
Monoclonal Antibody to Complement Component 3a (C3a)
TRV-0033481-02 100 µL

Monoclonal Antibody to Complement Component 3a (C3a)

Sign In for Pricing
View Details
Monoclonal Antibody to Complement Component 3a (C3a)
TRV-0033481-03 200 µL

Monoclonal Antibody to Complement Component 3a (C3a)

Sign In for Pricing
View Details
Monoclonal Antibody to Complement Component 3a (C3a)
TRV-0033481-04 1 mL

Monoclonal Antibody to Complement Component 3a (C3a)

Sign In for Pricing
View Details