Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit a (atpB)

This Recombinant ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-251.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

P45829

Expression Region

1-251

Origin

Mycobacterium leprae

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTETILSGGQIEVGEHHTTTWFGMTVNTDTVLSTAIAAAIVIALAFFLRTKVNSTGVPCG MQLFWEAITVQMRTQIESAIGMRIAPFVLPLAVTIFVFILISNWLSVLPLQYTNADGHTT EVLSSAAADINYVLALAFFVFVCYHLAGIWRRGIVGHPVAVLKGHVAFLAPINLVEEITK PISLSLRLFGNIFAGGILVTLIALFPPYIMWAPNAIWKSFDLFVGAIQAFIFSILTILYF SQAMEVEDHHD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAMTS8 Antibody
KC-3316-01 50 μL

ADAMTS8 Antibody

Sign In for Pricing
View Details
ADAMTS8 Antibody
KC-3316-02 100 µL

ADAMTS8 Antibody

Sign In for Pricing
View Details
ADAMTS8 Antibody
KC-3316-03 1 mL

ADAMTS8 Antibody

Sign In for Pricing
View Details
ACAT2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A8]
TA501218AM 100 µL

ACAT2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A8]

Sign In for Pricing
View Details
Endoglin / CD105 (ENG/1621), Biotin conjugate, 0.1mg/mL
BNCB1621-100 1x 100 µL

Endoglin / CD105 (ENG/1621), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TTF1 Antibody
KC-3371-01 50 μL

TTF1 Antibody

Sign In for Pricing
View Details