Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit a (atpB)

This Recombinant ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-251.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

P45829

Expression Region

1-251

Origin

Mycobacterium leprae

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTETILSGGQIEVGEHHTTTWFGMTVNTDTVLSTAIAAAIVIALAFFLRTKVNSTGVPCG MQLFWEAITVQMRTQIESAIGMRIAPFVLPLAVTIFVFILISNWLSVLPLQYTNADGHTT EVLSSAAADINYVLALAFFVFVCYHLAGIWRRGIVGHPVAVLKGHVAFLAPINLVEEITK PISLSLRLFGNIFAGGILVTLIALFPPYIMWAPNAIWKSFDLFVGAIQAFIFSILTILYF SQAMEVEDHHD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-P-PDOT
B6559-25 25 mg

4-P-PDOT

Sign In for Pricing
View Details
CD106 Antibody / VCAM1
V8468SAF-100UG 100 µg

CD106 Antibody / VCAM1

Sign In for Pricing
View Details
Lentiviral mouse Pter shRNA (UAS) - Lentiviral mouse Pter shRNA (UAS, RFP) plasmid
GTR15227353 1 Vial

Lentiviral mouse Pter shRNA (UAS) - Lentiviral mouse Pter shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Hsa-miR-130a-3p inhibitor
HY-RI00241-01 5 nmol

Hsa-miR-130a-3p inhibitor

Sign In for Pricing
View Details
Hsa-miR-130a-3p inhibitor
HY-RI00241-02 20 nmol

Hsa-miR-130a-3p inhibitor

Sign In for Pricing
View Details
Albendazole sulfoxide
259024-01 500 mg

Albendazole sulfoxide

Sign In for Pricing
View Details